PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_014958-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 318aa    MW: 35924.3 Da    PI: 6.7387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_014958-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-132974146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEd+ l++ v+++G+++W++I ++  + Rt+k+c++rw +
  AHYPO_014958-RA 29 KGPWKAEEDQVLLKHVQKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 74
                     79*************************8887799**********87 PP

2Myb_DNA-binding40.56.3e-1385124344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE++  +d  ++ G++ W++Ia +++ gRt++++k++w
  AHYPO_014958-RA  85 KFSKEEEKVVIDMQAEIGNK-WARIATYLP-GRTDNDVKNFW 124
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.8972480IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-202777IPR009057Homeodomain-like
SuperFamilySSF466891.42E-2728124IPR009057Homeodomain-like
SMARTSM007177.1E-112878IPR001005SANT/Myb domain
CDDcd001674.37E-113176No hitNo description
PfamPF139213.7E-143291No hitNo description
Gene3DG3DSA:1.10.10.602.8E-1778130IPR009057Homeodomain-like
PROSITE profilePS5129416.51181132IPR017930Myb domain
SMARTSM007176.6E-1182130IPR001005SANT/Myb domain
CDDcd001673.89E-985124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MKTEKECLMK EMRSSSSNSG EGKEIVLRKG PWKAEEDQVL LKHVQKYGPR DWSSIRSKGL  60
LQRTGKSCRL RWVNKLRPNL KNGCKFSKEE EKVVIDMQAE IGNKWARIAT YLPGRTDNDV  120
KNFWSSRQKR LARLLVSQNN PRTKKRKSSP IDTANSSQVA KNCSTSVGET SSNTQSQIIS  180
YPGSTDNNCL SIEPNNVTDC LQPIPLNQEY NNTNYPNLFL SEEEICFPSI PYNQTDLMFV  240
PETQEIIDSL DYSFFNPFDS SYNPAAFVND GTHFPPCSYG GDLSGETTTA SLKTENLGIS  300
NCLWDDIPLD MFDHQFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-292713025126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692444.12e-94PREDICTED: transcription factor WER
TrEMBLB9RD282e-78B9RD28_RICCO; R2r3-myb transcription factor, putative
TrEMBLI1KJM81e-78I1KJM8_SOYBN; Uncharacterized protein
TrEMBLM5VT839e-79M5VT83_PRUPE; Uncharacterized protein
STRINGGLYMA07G14480.13e-78(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.15e-69MYB family protein